Benutzer:IvanP/Rekorde

Aus Wiktionary, dem freien Wörterbuch
Zur Navigation springen Zur Suche springen

Wort mit den meisten Bedeutungen[Bearbeiten]

Laut einer Ausgabe des Guinnessbuchs haben Schüler des Finsterwalder-Gymnasiums in Rosenheim herausgefunden, dass das Wort Läufer die meisten Bedeutungen hat, nämlich 24. Auf die gleiche Anzahl bringt es das Wort Sinn im Grimm, der allein 24 Bedeutungen für das transitive machen verzeichnet, hinzu kommen 6 Bedeutungen für das reflexive und 9 Bedeutungen für machen mit Fortlassung eines Objekts, insgesamt also 39 Bedeutungen.

Welches Wort denn nun tatsächlich die meisten Bedeutungen hat, hängt von der Zählung ab. Es werden zwei Arten von Äquivokation (Gleichlautung) unterschieden: Homonymie und Polysemie. Die Idee hinter einer Differenzierung dieser Termini ist die folgende: Ein Polysem ist ein Wort mit mehreren Bedeutungen. Homonyme sind mehrere Wörter, die gleich lauten. Wie lässt sich das nun unterscheiden? Schule kann für die Institution stehen („ich gehe zur Schule“) oder aber für alle dort Anwesenden („die Schule brach in großes Gelächter aus“). Daher ist es sinnvoll, Schule als Polysem zu bezeichnen, und die Bedeutungen in einem Wörterbuch unter einem Stichwort zusammenzufassen. Dagegen gibt es einerseits kraulen von englisch to crawl und andererseits kraulen von krauen. Der Gleichklang ist rein zufällig, daher ist es sinnvoll, von zwei unterschiedlichen Homonymen auszugehen und die Bedeutungen in separaten Einträgen zu nennen.

Natürlich ist die Abgrenzung nicht immer sehr einfach und überhaupt ist nicht immer so klar, ob verschiedene Bedeutungen vorliegen. Bei Schule lässt sich die Testfrage stellen: „Sind das Schulgebäude und alle da drin zwei Schulen?“ Die Antwort ist ein klares Nein. Vielmehr ist das Schulgebäude eine Schule in dem einen Sinne, alle da drin hingegen eine Schule in dem anderen Sinne. Diese Frage ist aber kaum durchführbar, um etwa diese Unterbedeutungen des Verbs machen im Duden auseinanderzuhalten:

14. a. (umgangssprachlich) (in Bezug auf einen zu entrichtenden Geldbetrag) ausmachen, betragen

14. b. (umgangssprachlich) (in Bezug auf das Ergebnis einer Addition, Subtraktion oder Multiplikation) ergeben

Wie wäre hier die Frage? Etwa so: „Sind zwei Euro und ein Drittel zwei Sachen, die gemacht werden?“ Nun ja, sind denn „ein Drittel und zwei Drittel“ zwei Sachen, die gemacht werden? Das würde alles unter 14. b. fallen, aber die Frage lässt sich so nicht bejahen.

Mit den Unterbedeutungen kommt das Wort machen übrigens auf 24 (20 Hauptbedeutungen), wie das Wort Läufer.

Längste chemische Bezeichnung[Bearbeiten]

Drei Jahre hat Dmitri Golubowski versucht, in der Zeitschrift Esquire das „längste Wort der Welt“ zu veröffentlichen, und stieß dabei auf Widerstand des (nun ehemaligen) Redakteurs Filipp Bachtin. Verzweifelt las es für esquire.ru vor. Dabei soll es sich um einen 189 819 Buchstaben langen Namen des Proteins Titin handeln. Dass das Video geschnitten wurde (ca. 21:35, 29:50, 43:10, 53:20, 1:05:00, 1:15:45, 1:26:25, 1:34:35, 1:46:50, 1:58:55, 2:09:20, 2:20:00, 2:30:35, 2:40:55, 2:51:25, 3:01:55, 3:17:45) und ihm deswegen ein Bart wächst und die Pflanze stirbt, ist klar. Nicht so klar hingegen dies:

Der pastebin.com-Link in der esquire.ru-Beschreibung führt zu einem anderen Wort („Methionylalanylthreonylserylarginyl...leucine“ – vorgelesen von MrBeast („Reading The Longest English Word (190,000 Characters)“), tatsächlich nur 64 060 Buchstaben lang) als das in der Beschreibung eines (nicht mehr verfügbaren) YouTube-Videos zitierte „Methionylthreonylthreonylglutaminylarginyl...isoleucine“. Letzterem Wortanfang und -ende entspricht das, was er vorlas, damals auch ein Wort im Blog von Sarah McCulloch.

Die Namen stehen für Aminosäuresequenzen (Primärstrukturen). Es gibt 20 kanonische Aminosäuren:

Aminosäure Code Acylgruppe russisch Anzahl
Alanin A alanyl аланил 3060
Arginin R arginyl аргинил 1337
Asparagin N asparaginyl аспарагинил 1219
Asparaginsäure D aspartyl аспартил 1215
Cystein C cysteinyl цистеинил 202
Glutamin Q glutaminyl глутаминил 1738
Glutaminsäure E glutamyl глутамил 1178
Glycin G glycyl глицил 1419
Histidin H histidyl гистидил 202
Isoleucin I isoleucyl изолейцил 1507
Leucin L leucyl лейцил 2348
Lysin K lysyl лизил 854
Methionin M methionyl метионил 385
Phenylalanin F phenylalanyl фенилаланил 1100
Prolin P prolyl пролил 1524
Serin S seryl серил 1814
Threonin T threonyl треонил 1788
Tryptophan W tryptophyl триптофил 245
Tyrosin Y tyrosyl тирозил 870
Valin V valyl валил 1933

Die Namen der Acylgruppen entstehen nach der IUPAC-Nomenklatur (3AA-9.3.), indem das Suffix -in (oder -an in Tryptophan) jeder Aminosäure durch -yl ersetzt wird, mit Ausnahme von asparaginyl für Asparagin wegen der Asparaginsäure (aspartyl), glutaminyl für Glutamin wegen der Glutaminsäure (glutamyl) und cysteinyl für Cystein wegen der Cysteinsäure.

Wie sich herausstellt, steht der Name auf pastebin.com für Nesprin-1, nicht Titin. Der Name ist möglicherweise zuerst in Wikisource aufgetaucht. Von Titin gibt es mehrere Isoformen mit unterschiedlichen Aminosäuresequenzen, womit sich die entsprechenden Namen auch unterscheiden und eine Länge von 189 819 Buchstaben durchaus übertreffen können. In esquire.ru heißt es, Titin bestehe aus 34 350 Aminosäuren, der vorgelesene Name entspricht aber nicht dieser Anzahl (siehe Tabelle oben und Tabelle unten). Laut Nina Weber zeigt das entsprechende Gen beim Menschen, dass Titin theoretisch gut 38 000 Aminosäuren enthalten kann, bei Golubowski sei es wahrscheinlich die Variante im menschlichen Herzmuskel. Allerdings enthält der Name, der sich einst in McCullochs Blog fand, einige Bestandteile, die da nicht hingehören (die Abkürzungen habe ich mir ausgedacht): Benutzer -sche fielen titinmethionyl und serx auf, Benutzer androl darüber hinaus acetyl und ethionyl.

Code Acylgruppe Anzahl
Xac acetyl 82
Xet ethionyl 1
Xse serx 1
Xti titin 81

Bei ethionyl (Ethionin ist eine nichtproteinogene Aminosäure) und serx kann es sich um Tippfehler für methionyl und seryl handeln, was aber machen acetyl (die Acetylgruppe stammt von der Essigsäure, die kein Amin ist) und titin (ein Selbstbezug) im Namen? Wenn die als Tippfehler interpretierbaren Bestandteile korrigiert werden und

  • p = PPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHNIEPEKMLAALKVFVQPMKAATRXacSYSITSPSQFVFLSSVWADPIELLNVCTSSLGNQFQTQQARTTQVQQFSQVWKPFPQSTVRFPGDVYKVYRYNAVLDPLITALLGTFDTRNRIIEVENQQSPTTAETLDATRRVDDATVAIRSANINLVNELVRGTGLYNQNTFESMSGLVWTSAPAXtiMQRYESLFA
  • i = ICPPDADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAA
  • m = MTTQRYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVQESAPFRQAALRHNVAPIF(ip)4

gesetzt wird, lässt sich der ganze Name komprimieren mit: m20, p, p.substr(0, 165), p.substr(160, 165)2, i. Der Name ist ein Märchen, interessanterweise besteht jedoch der wohlgeformte Name (nach dem dargelegten Schema) eines unter kinase.com genannten Titins (26 926 Aminosäuren), der erstmals möglicherweise ebenso in Wikisource aufgetaucht ist, auch aus 189 819 Buchstaben. 2016 hat McCulloch sich schließlich geäußert: „I created this page from a site that no longer exists, which inexplicably posted what you see above on a single line. I copied it, formatted it, and then posted it here so it was actually readable.“ Nach einem Hinweis von Stephen Thomas ersetzte sie das Wort, allerdings hat das jetzige eine abweichende Buchstabenlänge, obwohl in ihrem Blog immer noch steht: „Its full chemical name is 189,819 letters long and, depending on how you define a “word” is the longest word in the English language.“ Sie könnte das ursprüngliche Wort von othyr.com/titin.html übernommen haben. Ein Link auf diese Seite wurde von der IP 71.112.43.223 in die englischsprachige Wikipedia eingefügt, die auf der Diskussionsseite anmerkte: „I just put up the word on an external site off of what had been deleted in the article, and linked to it. I hope this is a solution everyone is fine with. Email me at titin @at OTHYR DaWT com if there are any issues with it.“ Nur gibt es othyr.com nicht mehr.

(Die folgenden Angaben gehen davon aus, dass das, was Golubowski vorlas, das einst unter esquire.ru in kyrillischer Schrift dargestellte Wort repräsentiert; etwaige Abweichungen hiervon werden als Missgeschicke beim Sprechen gewertet – zum Beispiel sagte er einmal ungefähr glutamin…glutaminyl statt glutaminyl – und nicht berücksichtigt.) Golubowski übersprang serx und titin und sagte stets cysteyl statt cysteinyl. Die restlichen Abweichungen sind isoisoleucyl statt isoleucyl und ein ausgelassenes iso an 19 Stellen. Dies führt zu einer abweichenden Länge von 188 949 Buchstaben. Er las das Wort eigentlich in russischer Sprache vor, in der es aus 185 429 Buchstaben besteht, doch kann dies auch als Englisch mit russischem Akzent gewertet werden.

Laut Guinness World Records ist der systematische Name der Desoxyribonukleinsäure der menschlichen Mitochondrien (16 569 Nukleotidreste) ca. 207 000 Buchstaben lang. Bei der Sequenz handelt es sich um die Cambridge Reference Sequence; das Original (5123-mal Adenin, 5175-mal Cytosin, 2177-mal Guanin und 4094-mal Thymin) und die revidierte Version sind in MITOMAP zu finden. Wie kommt es zu der Wortlänge? Bonnie Taylor äußerte dazu zunächst: „I'm unsure, though, how we're to believe that this yields a "word" or "name" of total length of 207,000 letters unless one were to substitute the full base name for each individual "a" or "t," etc., and then maybe add a "deoxyribo-" as a prefix to yield individual nucleoside names. I guess that would be something like "deoxyriboadenyl, deoxyriboguanyl, deoxyribocytosyl, lather, rinse, repeat … acid."“ Auf Tausender gerundet wäre der Name mit solchen Bestandteilen aber zu lang, auch mit deoxyadenosyl, deoxycytidyl, deoxyguanosyl und deoxythymidyl, während er mit adenyl, cystosyl usw. zu kurz wäre. Taylor stellte später fest, dass sich die Sequenz auf die Basen einer Einzelstrang-DNA bezieht, und meinte, dass sich ein „Name“ von 207 000 „Buchstaben“ auf die Namen der einzelnen Basen statt Nukleoside beziehen könnte. Es kann sein, dass genau dies der Fall ist, wobei 207 000 nicht die auf Tausender gerundete tatsächliche Wortlänge ist (der Name wäre dann nämlich zu kurz), sondern eine Schätzung, die sich aus der Annahme ergibt, jede Nukleinbase komme genau gleich oft vor, zumal es (Fettdruck von mir) „contains 16,569 nucleotide residues and is thus c. 207,000 letters long“ heißt. GWR bezeichnet den Namen als den längsten wissenschaftlichen, gleichwohl ist zum Beispiel der Name einer Isoform des Titins von Patagioenas fasciata monilis (vorhergesagt) mit 260 241 Buchstaben im Deutschen (einer mehr im Englischen wegen des -e am Ende) länger – siehe auch Thomas –, die entsprechende genomische DNA hat einen noch längeren Namen und überhaupt lassen sich beliebig lange chemische Namen konstruieren. Ein hypothetisches Clostridiales-Protein bringt es sogar auf 520 431 Buchstaben im Deutschen. Weitere Kuriositäten aus der Chemie sind:

  • „Wer gegen ein Minimum Aluminium immun ist, besitzt Aluminiumminimumimmunität.“ (vgl. Schüler-Sprüche) – Variante: „Wer gegen Aluminium minimal immun ist, besitzt Aluminiumminimalimmunität.“ (Das Minimum-Bandwurmwort hat mehr aufeinanderfolgende Zacken in Sütterlinschrift.)
  • isopropylpropenylbarbitursaures Phenyldimethyldimethylaminopyrazolon (bekannt aus In der Apotheke mit Karl Valentin, bei der dritten Wiederholung lässt Liesl Karlstadt ein dimethyl weg; Verbindung von Aminophenazon mit Aprobarbital; findet sich auch falsch zitiert, in Der Coup, die Kuh, das Q von CUS etwa als Isopropilprophemilbarbitursauresphenildimethildimenthilaminophirazolon)
  • (6R,7R)-7-{[(2Z)-2-(2-Amino-1,3-thiazol-4-yl)-2-(methoxyimino)acetyl]amino}-3-{[(2-methyl-5,6-dioxo-1,2,5,6-tetrahydro-1,2,4-triazin-3-yl)sulfanyl]methyl}-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-en-2-carbonsäure (Ceftriaxon)
  • Siehe auch saippuakivikauppias.

Isogramme, Asogramme, Heterogramme[Bearbeiten]

Das Wort Isogramm wurde 1965 von Dmitri A. Borgmann in seinem Buch Language on Vacation eingeführt (englisch isogram) und bezeichnet ein Wort oder eine andere verbale Entität, in der jeder Buchstabe gleich oft vorkommt. Da dieser Ausdruck eine weitere Bedeutung mit sich bringt (Isolinie), schlug er später die Bezeichnung asogram vor, die rückwärtsgelesen margosa ergibt (wobei das im Deutschen mit Asogramm nicht funktioniert). Durchsetzen konnte sie sich nicht.

Im engeren Sinne ist ein Isogramm ein Soloisogramm (Borgmann: solo isogram), also ein Isogramm, in dem jeder Buchstabe genau einmal vorkommt, etwa Katze. Bei genau zweifachem Vorkommen ist von Paarisogrammen (Borgmann: pair isograms) die Rede, bei genau dreifachem von Trioisogrammen (Borgmann: trio isograms), darüber hinaus kann von Tetraden-, Pentaden- und Hexadenisogrammen (Borgmann: tetrad, pentad, and hexad isograms) gesprochen werden. Soloisogramme werden auch Heterogramme genannt. Jeremy H. Marshall schlug die Namen Haplogramm, Diplogramm bzw. Triplogramm für Iso-, Paar- bzw. Trioisogramme vor. In Gabay’s Copywriters’ Compendium werden Diplogramme (diplograms)/Triplogramme (triplogram) definiert als Wörter, in denen jeder unterschiedliche Buchstabe nur (also höchstens?) zwei-/dreimal auftaucht. Außerdem findet sich dort quadrigram (jeder Buchstabe nur viermal) statt – wie es konsequent wäre – quadriplogram. Unter Heterogrammen werden auch aus fremden Sprachen entlehnte Schreibungen verstanden, die in der Zielsprache als Logogramme fungieren (z. B e.g. für for example statt (nur selten so gelesen) exempli gratia im Englischen), und als Haplogramme werden manchmal Produkte der Haplografie (d. h. falscher Auslassung von zwei gleichen oder ähnlichen Teilen beim Schreiben) bezeichnet. Siehe Verzeichnis Diskussion:Deutsch/Heterogramme für weitere Überlegungen.

Borgmann unterschied bei Paarisogrammen zwischen ordinären Exemplaren mit einer „ungeordneten“ Buchstabenanordnung und „gemusterten“ Exemplaren, bei denen die letzte Hälfte eine Umstellung der ersten Hälfte ist. Seine Ansicht war: Weist ein Paarisogramm bilaterale Symmetrie auf, weil es aus separaten, klar erkennbaren, strukturellen Elementen besteht, die Umstellungen voneinander sind und verbunden wurden, um das Isogramm zu formen, dann ist diese Symmetrie nichts Bemerkenswertes. Als Beispiel aus dem Deutschen mag lauffaul herhalten, bestehend aus den Anagrammen lauf und faul. Eingruppierung und interniert haben dagegen eine „zufällige“ Symmetrie und verdienen eine Auszeichnung. In seiner Betrachtung von Isogrammen schloss Borgmann in Language on Vacation drei Klassen von Wörtern aus, nämlich Palindrome wie Tannat oder Revilo P. Oliver, Tautonyme wie Cha-Cha-Cha oder Angang sowie Wörter, die einen Isogrammstatus beanspruchen, aber von einer oder mehr identischen Buchstabengruppen verkrüppelt werden. Eine Spezialform von Heterogrammen sind diejenigen, in denen jeder Buchstabe alphabetisch sortiert ist und die ich Alphabeterogramme nenne, bei umgekehrter Reihenfolge Reversalphabeterogramme.

Eine Sonderform sind echte oder perfekte Pangramme. Dies sind Heterogramme, in denen jeder Buchstabe des Alphabets vorkommt.

So viel zur Namensgebung.

Deutsch[Bearbeiten]

Bei einer Preisaufgabe in Der Sprachdienst (Heft 2/1979) der Gesellschaft für deutsche Sprache (GfdS) ging es darum, lange Wort-Heterogramme zu konstruieren. Durch intensives „Kopfschwitzgrübeln“ (18 Buchstaben) entstanden bei diesem „Wortdschungelkampf“ (18 Buchstaben) von 27 Lesenden insgesamt 329 Lösungen:

  • 138 Wörter mit 15 Buchstaben, darunter: Klatschweibmund, Mondkupferstich, Ostdänemarkflug, Polarfuchsgebiß, Schankwirtpodex, Schlumpfzwinger, Sprachbolzentum, Vogelschutzpark, Wickelbäratzung
  • 67 Wörter mit 16 Buchstaben, darunter: Atomphysiklügner, Dorfschmutzgabel, Gymnastiklehrjob, Jupitermondschaf, Schmutzfinkplage, Wachstropfenbild, Werkpaßfälschung (nicht mehr gültige Schreibweise)
  • 57 Wörter mit 17 Buchstaben, darunter: Atomphysikjuxlüge, Gaskochwunderfilm, Giftschmankerlbox, Gurtklopfmaschine, Kochwurstleimpfad, Märzbuchnostalgie, Paktschwindelbüro
  • 26 Wörter mit 18 Buchstaben, darunter: Kopfwildjägerschau, Putzfroschkönigbad, Quarktopfschwindel, Zweikampfübungsort, Zwölftonmusikhader
  • 27 Wörter mit 19 Buchstaben, darunter: Kampfschwundblitzer, Kultzopfüberschwang, Wärmflaschenputzjob, Wildparkschutzbogen
  • 5 Wörter mit 20 Buchstaben: Atomphysikverblödung, Atomphysikverdüblung, Fegwindvorschubplatz, Milchboxprüfungsakte, Zapfweibglücksyndrom
  • 3 Wörter mit 21 Buchstaben: Kopfbrandschutzmixgel, Ölnußimportsackgewühl (nicht mehr gültige Schreibweise), Rumpfschnitzeljagdbox
  • 5 Wörter mit 22 Buchstaben: Atomfysikjähverblödung (orthografisch falsch), Atomfysikzähverblödung (orthografisch falsch), Atomphysiknußwürgebold (nicht mehr gültige Schreibweise), Mixkotpflanzwuchsbürde, Zimtäpfelschwungradboy
  • 1 Wort mit 23 Buchstaben: Boxkampfwürgschlundzeit

Viele dieser Bildungen ergeben kaum Sinn. Der Preis ging an Jochen Hölzer aus Herne. Er hat eingesandt:

  • 23 Wörter mit 15 Buchstaben
  • 9 Wörter mit 16 Buchstaben, darunter: Schießplatzübung
  • 8 Wörter mit 17 Buchstaben, darunter: Hockeyübungsplatz
  • 2 Wörter mit 18 Buchstaben, darunter: Fußgymnastikbücher
  • 3 Wörter mit 19 Buchstaben: Boxkampfschilderung, Fachbildungsprojekt, Zwölftonmusikbücher

Im Heft 3/1988 wurde das Thema erneut aufgegriffen. Gewonnen hat Wolfgang Theis aus Harsewinkel mit Heizölrückstoßabdämpfung (24 Buchstaben). „Längstes deutsches Wort hat 24 Buchstaben“, titelte das Hamburger Abendblatt irreführend. Laut Gerald Steffens fand er das Wort mithilfe eines Atari 1040ST. Diese „Nichtsnutzvokabel“ (Stuttgarter Zeitung) bezeichnet etwa die Abdämpfung des Rückstoßes, der beim Leitungstransport von Heizöl entstehen kann. „Ob die Techniker hier bedenklich die Stirn runzeln werden?“, fragt der Sprachdienst. Hubert Schölnast erklärte einst (Facebook): „[J]eder, der mal einen Gartenschlauch in der Hand hatte, aus dem das Wasser so richtig rausschießt, wird wissen, dass das einen Rückstoß erzeugt. Lässt man dem Schlauch freies Spiel, tanzt er wild herum und spritzt alles voll Wasser. Beim Wasser ist das ein Wasserrückstoß, beim Heizöl eben ein Heizölrückstoß. Und um mit dem Öl-Schlauch sicher hantieren zu können [sic; fehlendes Komma] wäre natürlich ein Mechanismus vorteilhaft, der diesen Rückstoß abdämpfen könnte. Und wenn es diesen Mechanismus gäbe, würde man ihn selbstverständlich Heizölrückstoßabdämpung [sic] nennen.“ „Diesen Mechanismus gibt es tatsächlich! Dadurch, dass nämlich der Heizölschlauch immer am Einfüllstutzen des Haus-Tanks angeschraubt wird, wird der sonst entstehende Rückstoß auf geniale Weise so sehr abgedämpft, dass er gar nicht mehr in Erscheinung tritt.“ Tatsächlich gebräuchlich ist Rückstoßdämpfung, es gibt sogar eine Belegstelle für Rückstoßabdämpfung und eine für Ölrückstoßdämpfung. Ein zweiter – gleichwertiger – Preis ging an Georg Altvater aus Mannheim für seine Zwölftonmusikbücherjagd, auch wenn das Wort einen Buchstaben weniger hat. Seine Erklärung dazu:

Es gibt Bücher, die von der Zwölftonmusik handeln. Sammelt jemand solche Zwölftonmusikbücher, so begibt er sich hin und wieder auf die Jagd nach ihnen, also auf die Zwölftonmusikbücherjagd.

Längere Wörter – darunter Fürwitzmädchenjuxklapsboß (25 Buchstaben; nicht mehr gültige Schreibweise), Zwölfnächtejagdspukmixbüro (26 Buchstaben; mit der Zwölfnächtejagd wird die Wilde Jagd gemeint sein, doch dann wird es schwierig) oder Blökvampquerschwingfüßätzoxyd (29 Buchstaben) – haben die Jury trotz zumeist mitgelieferter Erklärung nicht überzeugt. Zu den anderen eingesandten Dreiundzwanzigern gehören Zwölftonjagdmusikbücher (von einem anderen Einsender!), Wildschützbärenjuxkampf und Boxkampfjuryschützlinge. In Wildschütz scheint es keinen Bärenkampf zu geben, interessant ist aber, dass die Kombination Wildschütz, Germany (17 Buchstaben) im Englischen ein heterogrammatisches Toponym ist.

Für gebräuchliche Wörter verweise ich auf Verzeichnis:Deutsch/Heterogramme. Vereinzelt kommt auch Kopfschmerzbildung (18 Buchstaben; [1], [2] [3], [4]) vor. Als Paarisogramme mit 18 Buchstaben habe ich Angriffsstrategien und Erzeugungsprinzips ausfindig gemacht. Weitere Fundstücke:

  • 17 Buchstaben: Pokalbeschriftung, Polarfuchskäfigen, Rotwildbekämpfung, Subdermatoglyphik
  • 18 Buchstaben: Bürodschungelkampf, Großkatzenimpfbuch, Knoblauchgewürzdip, Witzboldaufmärsche
  • 19 Buchstaben: Fußgymnastiklehrjob, Großkatzenimpfbuchs, Jagdkniestrumpfloch, Knoblauchgewürzdips, Malzwhiskyduftprobe, Wildbachverstopfung, Witzboldaufmärschen
  • 20 Buchstaben: Boxkämpferschützling, Dorfplatzschießübung, Malzwhiskyduftproben, Videomarktlöschübung, Zylinderhutwompfsack (?), Zylinderkopfwachstum, Zylinderkopfwaschgut
  • 21 Buchstaben: Judokämpferschützling, Konvexrumpfschwitzbad, Plüschfigurwandobjekt
  • 22 Buchstaben: Boxkampfjuryschützling, oxydschmelzpunktfarbig
  • 24 Buchstaben: Blutmixgefäßrückwandshop

Alphabeterogramme haben im Duden bis zu 7 Buchstaben:

  • 5 Buchstaben: Abort, Achim, adeln, Adept, Bijou, Chino, Chlor, Delos, Demos, einst, Filou, First, Forst, Horst, Klops, Klotz, Knorz
  • 6 Buchstaben: Achims, behost, Chinos, Chintz, Chlors, Dehors, Dekort
  • 7 Buchstaben: Ägilops, Beikost

Der wissenschaftliche Name Aegilops bringt es auf 8 Buchstaben. Von den Reversalphabeterogrammen gibt es auch nicht viel größere:

  • 5 Buchstaben: Polka, solid, Sonja, Tonga, Trieb, Triga, Troja, ulkig, Uroma, Vroni, Wolfe, Wölfe, Wolga, Wolke, Ytong, Zunge
  • 6 Buchstaben: ulkige, unlieb, wolkig, wurmig
  • 7 Buchstaben: wolkige, wurmige

Für echte Pangramme verweise ich auf die FAQL.

Englisch[Bearbeiten]

Informationen zu Isogrammen im Englischen bietet Word Ways.

Schach-Math[Bearbeiten]

Am 28. Dezember 2011 trat Robin Wersig (in einigen Berichten fälschlicherweise „Robert Wersig“) in der ZDF-Show Deutschlands Superhirn auf und siegte (über sechs andere, die mitgemacht haben) mit folgender Darbietung: Er belegte ein Schachbrett so mit Zahlen, dass jede Zeile und Spalte die gleiche Summe (vorgegeben) hat, und zwar blind und im Rösselsprung, beginnend mit einem vorgegebenen Schachfeld. Er nennt die Disziplin laut der Lausitzer Rundschau Schach-Math (dort mit Leerzeichen statt Bindestrich; Wortspiel: nicht „Matt“, sondern „Math[ematik]“; für eine Verwendung in anderer Bedeutung vgl. Jahr der Mathematik) und in einem früheren YouTube-Video ist zu sehen, wie er die Aufgabe in einer angeblichen Weltrekordzeit von 3 Minuten 5 Sekunden erledigt. Der Neurobiologe Tobias Bonhoeffer kam zu Wort und attestierte Wersig ein ungeheures Arbeitsgedächtnis.

In Wirklichkeit ist es ziemlich banal: Wir prägen uns eine geschlossene Springertour ein; nach diesem Zyklus können wir das Brett dann von jedem Startfeld aus ablaufen. Außerdem lernen wir ein (semi)magisches 8 × 8-Quadrat auswendig. Die Summen betragen dann (mit den Zahlen von 1 bis 64) 260 (das ist die durch 8 geteilte Summe aller ganzen Zahlen von 1 bis 64).

8 38 34 15 25 12 62 51 23
7 42 32 17 53 8 4 45 59
6 27 13 36 40 21 49 64 10
5 18 56 43 31 46 58 5 3
4 35 37 26 14 63 11 24 50
3 29 41 54 20 1 7 60 48
2 16 28 39 33 52 22 9 61
1 55 19 30 44 57 47 2 6
a b c d e f g h

In Wersigs Fall musste die Summe 747 sein. In jeder Zeile und Spalte addieren wir jede Zahl bis auf eine mit A = 70 und die restlichen Zahlen (in den Mitteilungen der DMV nennt sich dies Transversale, Holger Dambeck spricht von der Traversale) mit B = −3: 260 + 7 ⋅ 70 − 3 = 747.

8 108 104 85 95 82 59 121 93
7 112 102 87 123 78 74 115 56
6 97 83 106 110 18 119 134 80
5 88 126 113 101 116 128 2 73
4 105 107 96 11 133 81 94 120
3 99 38 124 90 71 77 130 118
2 86 98 36 103 122 92 79 131
1 52 89 100 114 127 117 72 76
a b c d e f g h

Nachdem ich darüber einen Text veröffentlicht habe, ist die Agentur davidsonTV (glaube ich) auf mich aufmerksam geworden, die die Sendung 2011–2013 betreute („Redaktion, Entwicklung der Performances, Recherche + Cast Kandidaten“), deren Schreiben ich aber unbeantwortet stehen ließ, da ich dort nicht auftreten wollte. Tatsächlich war der Text nur eine Zusammenstellung von dem, was in der Sendung zu sehen war, und dem, was auf meine Frage, wie Wersig das gemacht hat, im Portal COSMiQ entgegnet wurde. Thomas Noll (Benutzer „mamuthfamily“) zur Wahl von A und B: „747 - 260 = 487. Man bestimmt die nächstgelegene durch 7 teilbare Zahl (größer oder kleiner) und teilt sie durch 7. Also 490 / 7 = 70. Außerdem merkt man sich den Rest. Also in diesem Falle -3. […] Auf youtube findet man noch ein anderes Beispiel von Robin Wersig: […] Dort geht es um die vorgegebene Summe 843. […] Nach "meiner" Strategie würde man 843 schreiben als 260 + 83 mal 7 + 2 und man würde folgende Lösung erhalten. […] Herr Wersig präsentiert dort allerdings eine andere Lösung, bei der komischerweise die Zahl 82 doppelt vorkommt. Entweder liege ich mit meiner Erklärung noch etwas daneben oder es spricht für Herrn Wersig und sein Arbeitsgedächtnis, dass er die Methode auch mal variiert.“

Dies wurde geklärt dank Benutzer „G.J.“: „Bei beiden Beispielen wählt er A als Vielfache von 10:“ „( A, B ) = ( 70, -3 ) bzw. ( 80, 23 ) […] Das macht die Addition einfacher.“ „Wenn die Differenz zwischen A und B kleiner als 64 ist, dann können so doppelte Einträge entstehen.“

So entstand im YouTube-Video das folgende Quadrat:

8 118 114 95 105 92 85 131 103
7 122 112 97 133 88 84 125 82
6 107 93 116 120 44 129 144 90
5 98 136 123 111 126 138 28 83
4 115 117 106 37 143 91 104 130
3 109 64 134 100 81 87 140 128
2 96 108 62 113 132 102 89 141
1 78 99 110 124 137 127 82 86
a b c d e f g h

Etwas früher erschien am gleichen Tag vom Gedächtnistrainer Boris Nikolai Konrad ein YouTube-Video, wobei nach der dort vorgestellten Methode nur die Traversale verändert wird; das Beispiel enthält freilich auch doppelte Einträge. Derselbe Boris Konrad gewann 2012 in Deutschlands Superhirn. Holger Kreymeier kommentiert (Forum), das Quadrat aus der ZDF-Sendung sei nach gängiger Definition gar kein magisches Quadrat, da die beiden Diagonalen nicht 747 ergeben, und beruft sich dabei auf die Definition in der Wikipedia. Diese verlangt übrigens auch, dass ein Quadrat der Kantenlänge n die Zahlen von 1 bis n2 enthält. Demnach ist ein magisches 8 × 8-Quadrat mit einer anderen Summe als 260 überhaupt nicht möglich. Aus den DMV-Mitteilungen:

  • „Naturgemäß wurden die benötigten Gedächtnis- und Rechenleistungen vom Moderator Pilawa und der versammelten Prominentenschar etwas übersteigert dargestellt. Die mit einem E = mc2 Videoclip [sic; fehlender Bindestrich] unterlegte Behauptung, Einstein wäre durch diese Aufgabe überfordert gewesen, war einfach nur lächerlich.“
  • „Nur er und der Zweitplatzierte Konstantin Struder hatten sich im eigentlichen Sinne mathematische Aufgaben gestellt. Daraus spricht vielleicht die Faszination von großen Zahlenschemata, deren Struktur auch für mathematisch Interessierte und Versierte nicht sofort ersichtlich ist.“

Kommentar: Skudler, nicht Struder.

  • „Es wurde offenbar unausgesprochen erwartetet [sic], dass die 64 Zahlen alle verschieden gewählt sein sollen […]. Interessanterweise hat Robin Wersig bei einer früheren, bis vor Kurzem auf Youtube sichtbaren, Vorführung eine Belegungszahl zweimal verwenden müssen, offenbar weil ihm während der Berechnung im Kopf doch ein kleiner Patzer unterlaufen war.“

Kommentar: Oder weil sich das aus seiner Methode so ergibt (siehe Kommentar von G.J.)! Vielleicht wusste er sogar von dem Problem, kann sich das aber trotzdem leisten, da die meisten gar nicht darauf kommen, dass bei ihm eine Zahl doppelt auftaucht und es ausreicht, die Diagonale mit der Summe zu füllen und den Rest mit Nullen, wenn es egal ist, wie oft eine Zahl vorkommt. Mittlerweile kann das Video mit dem entsprechenden Link wieder angesehen werden, ist jedoch ungelistet, wird also nicht von der YouTube-Suche gefunden.

  • „Offensichtlich konnte niemand erwarten, dass Wersig an die Aufgabe ohne jegliches System heranging [sic; fehlendes Komma] und dass er dieses erst einmal nicht verriet, war sein gutes Recht in diesem Kontext. Mittlerweile stehen mehrere Lösungsverfahren im Netz und in den Zeitungen, er wird sich also eine neue Aufgabe ausdenken müssen. […] [D]ie Überlagerung verschiedener, eigentlich voneinander unabhängiger Effekte, um die Zuschauer zu beeindrucken oder verwirren, ist sicherlich auch eine legitime Technik in Unterhaltung, Kunst und Literatur.“

In der Mediathek ist die Folge nicht mehr zu finden, aber soweit ich das in Erinnerung habe, demonstrierte Wersig auch, wie er durch 19 teilen kann, und brachte als Erklärung, dass das Ergebnis der Teilung durch 20 anzupassen ist. Erläuterung: Die Periode von 1/19 nach dem Komma ist 052631578947368421 (auswendig lernen!), eine zyklische Zahl. Wir führen eine Division mit Rest durch, wobei der Rest angibt, wo die Ziffernfolge anfängt. Zum Beispiel: 64/19 = 3 + 7/19 [Rest 7 heißt: anfangen bei 36…] = 3,368421052631578947.

Längstes unzusammengesetztes Wort[Bearbeiten]

Als das längste unzusammengesetzte Wort wird oft Unkameradschaftlichkeit (23 Buchstaben) genannt. Welche sind länger?

Es sollte gesagt werden, dass explizite Derivate, die gebundene grammatische Morpheme enthalten, nicht als Zusammensetzungen gelten, weswegen Unkameradschaftlichkeit durchaus als Beispiel für ein unzusammengesetztes Wort gelten darf.

CUS nennt im Buch Der Coup, die Kuh, das Q das Wort auseinanderposamentieren (24 Buchstaben). Zwar gebe es auseinander als eigenes Wort, doch sei es aus den Vorsilben aus (ausgehen), ein (einwerfen) und ander (anderweitig) zusammengesetzt, „und wer anderes behauptet, hat genauso recht“. Er wirft das Binaritätsprinzip über Bord, wonach Wörter (wenn möglich) in höchstens zwei Bestandteile zu zerlegen sind. Binarität besteht hier in meinen Augen tatsächlich, die Wortbildung bedient sich eben auch Wortbildungen selbst. Erst im zweiten Schritt ist auseinander in aus und einander zu zerlegen sowie posamentier in Posament und ier. Im dritten Schritt wird einander schließlich zu ein und ander. Wir schreiben diese Segmentierung als aus||ein|||ander|posament||ier.

Selbst ohne Berücksichtigung der Binarität bleibt der Status als unzusammengesetztes Wort umstritten, denn ebenso wie auseinander kommen doch auch aus und ein als eigenständige Wörter vor (ich gehe aus, werfe ein). Diese Verbzusätze erfüllen jedoch eine syntaktisch-semantisch ähnliche Funktion wie Präfixe und können mit einem Augenzwinkern durchgehen.

Wo treffen zwei Suffixe zusammen? Ich ziehe dazu Fleischer/Barz zurate: Bei Substantiven aus Substantiven begegnet uns immer ein -(l)er (Lehrerin, Wissenschaftler), Ausnahme ist -el-chen (Knöchelchen). Bei Substantiven aus Adjektiven und Verben ist es meistens -keit (Tragbarkeit), -igkeit (Wirkungslosigkeit) und -ung (Festigung). Unter den Adjektiven aus Substantiven finden sich -er-lich, -schaft-lich, -tüm-lich, -sal-haft, -nis-haft, -er-haft, -ling-haft, -er-isch sowie -ungs-los. Adjektive aus Adjektiven mit dieser Eigenschaft werden nicht mehr gebildet, zumindest wenn ausschließlich heimische Suffixe in Betracht gezogen werden, es finden sich als Restgruppe lediglich -ig-lich (elendiglich) und -haft-ig (wahrhaftig), wobei sich -ig-lich durch die ursprüngliche Funktion von -lich erklärt, Adjektive zu adverbialisieren. Adjektive mit Fremdsuffixen verbinden sich mit -isch (passivisch). Von den Präfixen ist un- bei Adjektiven ziemlich flexibel, Verben aus Verben mit dieser Eigenschaft sind nicht mit Suffixen realisierbar. Völlig unbeachtet blieb aber das Präfix ur-, das sich an Enkel, Oma und Opa beliebig oft anfügen lässt. (Interessant ist auch, dass es in urig als Basis einer Derivation fungiert.) Wir beachten es daher nicht weiter.

In der entsprechenden Preisaufgabe der GfdS wurde viermal die Vergenossenschaftlichung genannt, welche unbestritten ein Derivat ist, die gleiche Länge hat wie auseinanderposamentieren und im Online-Duden steht, daneben waren es Verburschenschaftlichung, Instrumentalisierbarkeit (auch 24 Buchstaben), Institutionalisierbarkeit (25 Buchstaben) und Uninternationalisierbarkeit (27 Buchstaben). Dort stellte sich das Problem mit Halbaffixen, die zwar selbstständig vorkommen, so jedoch eine andere Bedeutung haben; sie wurden als echte Affixe durchgelassen und so kamen Wörter wie Verabscheuungswürdigkeit, Unterdurchschnittlichkeit, Berücksichtigungsfähigkeit und Verschreibungspflichtigkeit hinzu, die aber mit 24, 25, 26 und 27 Buchstaben nicht mehr zu bieten haben.

Der Preis ging an Heidi Schultz-Amling aus Hofheim für die längste unbestreitbare Ableitung Vergenossenschaftlichbarkeit (28 Buchstaben) und Gottfried Beesk aus Berlin für die Pseudounterstützungsbedürftigkeit (33 Buchstaben), bei der er sich auf die Duden-Grammatik in der 5. Auflage berief, obwohl -bedürftig in der 6. Auflage nicht mehr als Ableitungssilbe verzeichnet ist, und die Unprämonstratenserinnenschaftlichkeit (37 Buchstaben), obwohl Zweifel aufkamen, ob Kollektiva auf -schaft ohne Weiteres mit -lich verbunden werden können, wenn sie nicht schon längst lexikalisiert und demotiviert (burschenschaftlich, genossenschaftlich) bzw. idiomatisiert (wirtschaftlich, herrschaftlich) sind, sondern die damit bezeichneten Mitglieder im Vordergrund stehen. (Lehrerschaftlich? Zuhörerschaftlich?)

Auf 24 Buchstaben bringt es Antiwissenschaftlichkeit.

Größtes lebendes Sprachgenie[Bearbeiten]

Ziad Fazah soll 58 Sprachen schreiben und sprechen und stellte dies angeblich unter Beweis, als er am 30. Juli 1991 bei einem Interview in Athen (GR) sein Publikum damit überraschte, dass er den Fragestellenden jeweils in ihrer Muttersprache antwortete. Es gab eine Diskussion darüber, ob er wirklich existiert. Tatsächlich war er in Viva el lunes zu sehen, ein klarer Beweis für seine Existenz, allerdings ist er dort am Sprachverständnis gescheitert.

Zuerst kam die Finnin Auli Leskinen:

Koko maailmassa on noin viisi miljoonaa ihmistä, jotka puhuvat suomen kieltä. Varmaan myös tiedätte, että Suomessa puhutaan virallisesti suomea, ruotsia ja saamen kieltä.

In der ganzen Welt sprechen rund fünf Millionen Menschen Finnisch. Wahrscheinlich wissen Sie auch, dass in Finnland offiziell Finnisch, Schwedisch und Samisch gesprochen wird.

Fazah übersetzte dies falsch:

En verdad me dijo que, cómo puedo por ejemplo aprender idiomas ah, finlandés, porque es totalmente un idioma de otra origen extranjera, y cómo, yo me siento aprendiendo este idioma, siendo de una otra cultura differente.

Stanislav Bosniak fragte ziemlich deutlich (russisch):

Какой сегодня день недели?

Welcher Wochentag ist heute?

Fazah antwortete schlicht какой („welcher“), was nicht wirklich eine Antwort ist. Chinesisch, Griechisch und Farsi konnte er auch nicht verstehen.

In seinen Büchern, aus denen sein voller Name Ziad Youssef Fazah hervorgeht, listet er alle 58 Sprachen auf, die er spricht:

Die Auflistung enthält unübliche Bezeichnungen wie Tadschikistanisch statt Tadschikisch. Allgemein lässt sich sagen, dass es nicht -istanisch, sondern -isch heißt.

Die einzige Ausnahme, die dabei gemacht wird, ist Pakistanpakistanisch. Zudem ist seine Auflistung unregelmäßig aufgebaut: So zählt er bei der chinesischen Sprache Mandarin, Kantonesisch und Shanghainesisch auf, während er Serbokroatisch als einzelne Sprache anerkennt, anstatt Serbisch und Kroatisch aufzuzählen (oder stattdessen die chinesischen Sprachen zu einer einzelnen Sprache zusammenzufassen).

Des Weiteren ist unklar, was Fazah mit Singapurisch meint. In Singapur wird offiziell Englisch gesprochen. Wahrscheinlich war Singlish gemeint, eine Varietät der englischen Sprache, die durch den Einfluss des Chinesischen und Malaiischen entstand. Vielleicht hat er die Sprache aber auch nur erfunden.

Die Sprachen Bhutanisch und Dzongkha sind eigentlich identisch, doch er listet sie beide auf, als wären sie zwei unterschiedliche Sprachen. Genauso unsinnig wäre es, zu sagen, mit Kölnisch und Kölsch zwei Sprachen zu sprechen.

In seinem Buch übersetzte er pouco chá (etwas Tee) mit few tea, es heißt aber some tea (da Singular).